Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Karl Lagerfeld Ikon Signature Choupette Handbag Natural White
Authorized Retailer

Ikon Signature Choupette Handbag Natural White

754 kr VAT included
Reduced price Regular price
  • There are only 3 item(s) left in stock.
  • Out of stock
Loading...Free
Standard Delivery
Free returns within 30 days
Leather goods seller since 1989
Secure payment
mobilepayklarnavisamasterpaypalapple_pay
Designed to be carried by hand or worn crossbody, this square handbag features a detachable strap for versatile styling. It is adorned with a bold Karl Signature and Ikon Choupette motif for a playful touch.
  • Contemporary square silhouette
  • Button closure to keep your belongings secure
  • Two top handles with a detachable and adjustable strap for versatile styling
  • Enhanced with contrasting Karl Signature and playful Ikon Choupette motifs
  • Composition: 65% Recycled cotton, 35% Cotton
  • Material: Knit
  • Made in: China
  • Height: 15 cm
  • Length: 18 cm
  • Width: 8 cm
  • Weight: 200 g
Dimensions
15 × 8 × 18 cm≈ 1.2 L
Caractéristiques
Type
Mini Bag
Portée
Hand, Crossbody Bag
Fermeture
Snap Button