Lancel BCBG S Handbag Black
Lancel BCBG S Handbag Black
Lancel BCBG S Handbag Black
Lancel BCBG S Handbag Black
Lancel BCBG S Handbag Black
Lancel BCBG S Handbag Black
Lancel BCBG S Handbag Black
Authorized Retailer

BCBG S Handbag Black

550€ VAT included
Reduced price Regular price
  • There are only 1 item(s) left in stock.
  • Out of stock

Genuine Leather

Loading...Free
Standard Delivery
Free returns within 30 days
Leather goods seller since 1989
Secure payment
paypalklarnaidealvisamasterapple_pay

Lancel BCBG Bowling Bag - Parisian Sophistication in Black Leather

This bowling bag from the BCBG line reveals the Parisian art of living through a timeless design. Crafted from black grained cowhide leather, it captivates with its exceptional finishes and functionality designed for the modern woman.

Exceptional Design and Finishes

The double L motif stitching and the heat-embossed "LANCEL PARIS" logo testify to artisanal expertise. Four metal feet elegantly protect the base, ensuring durability and shape retention.

Intelligent Organization

The interior reveals a refined textile lining housing four card slots, a slip pocket dedicated to papers and receipts, and a secure zippered compartment for your essentials.

Technical Specifications

  • Dimensions: 22.0 x 13.0 x 10.5 cm
  • Weight: 0.87 kg
  • Material: 100% Grained cowhide leather

Style Tips - Sophisticated Black

Pair this deep black with a beige trench coat and nude pumps for a Parisian office look. For the evening, match it with a burgundy midi dress and black heeled ankle boots. For a casual style, it elevates raw denim and an ecru cashmere sweater.

Leather Care

Clean gently with a soft, slightly damp cloth. Apply Lancel "Crème Essentielle" every 3-6 months to nourish and protect the leather. Store in a dry place, away from direct sunlight.

Dimensions
13 × 11 × 22 cm≈ 1.7 L
Caractéristiques
Type
Bowling Bag
Matière
Leather
Portée
Hand
Fermeture
Zippered