Affenzahn Sac À Dos 1 à 3 ans Petits Amis Owl
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Owl - 2
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Owl - 3
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Owl - 4
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Owl - 5
Affenzahn Sac À Dos 1 à 3 ans Petits Amis Owl - 6
Authorized Retailer

Small Friends Owl Backpack 1-3 Years

45€ VAT included
Reduced price Regular price
  • There are only 1 item(s) left in stock.
  • Out of stock
Loading...9,99€
Standard Delivery
Free from 120€
Free returns within 30 days
Leather goods seller since 1989
Secure payment
epsklarnapaypalvisamasterapple_pay

Affenzahn Little Friends Owl Backpack - Eco-Friendly Companion for Toddlers

This Affenzahn backpack turns the first steps towards independence into a playful adventure. Specially designed for children aged 1 to 3, it combines a charming animal design with environmental commitment thanks to its recycled polyester composition.

Playful and Functional Design

The Owl motif captivates with its expressive details and soothing blue color. The zipper, adapted for small hands, encourages learning independence, while the compact size suits the morphology of toddlers.

Environmental Commitment

Made from recycled PET bottles (48% recycled polyester), this backpack raises environmental awareness from an early age. A responsible choice that preserves the future of our children.

Technical Specifications

  • Dimensions: 17.0 x 11.0 x 25.0 cm
  • Weight: 0.2 kg
  • Material: 100% polyester, including 48% recycled

Care Instructions

Clean with a soft, slightly damp cloth. Allow to air dry away from direct heat. Store in a dry place to preserve the quality of the recycled polyester.

Dimensions
25 × 11 × 17 cm≈ 2.6 L
Caractéristiques
Type
Backpack
Matière
Recycled Polyester
Portée
Back
Fermeture
Zippered

Discover this product in our collections